PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0071s0176.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Trihelix
Protein Properties Length: 304aa    MW: 34923.3 Da    PI: 9.2639
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0071s0176.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.94.3e-2641124186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W+ qe+++ + +r e+++++ ++k++k lWe +s kmre+gf+rs+ qCk+kw+nl +ryk ++++e ++ s  ++++p++++++
  Kaladp0071s0176.1.p  41 QWSMQETKEFLMIRAELDRTFMETKRNKLLWEVISTKMREKGFNRSADQCKCKWKNLVTRYKGCETMEPDGMS--RQQFPFYSDMQ 124
                          7*********************************************************************954..556******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.83E-2540105No hitNo description
PfamPF138374.4E-2041124No hitNo description
PROSITE profilePS500907.344298IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEGRHHHHQH HHLAPQLAGT AGPSATTSME AAASGDSRFP QWSMQETKEF LMIRAELDRT  60
FMETKRNKLL WEVISTKMRE KGFNRSADQC KCKWKNLVTR YKGCETMEPD GMSRQQFPFY  120
SDMQGIFTAR LERALWSEAQ GGAAAAGSSG LARKRALSSS DEDEESDEGD QRTTAMTPTS  180
SNVRKKKKGK VANARSGGVG ELREILGEFM KQQMQMEAQW REAFEAREAE RRAREVEWIR  240
NMEALESERL SMERRWRERQ EQRMLREEAR AEKRDALITC LLNKLRREES SSASHHHQLP  300
PPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1342102767DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264622.11e-101PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-72TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A103YLU92e-99A0A103YLU9_CYNCS; Myb-like domain-containing protein
STRINGVIT_08s0105g00400.t015e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-54Trihelix family protein